MYOZ3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MYOZ3 Polyclonal antibody, PBS Only (23880-1-PBS)

• 

  WB analysis of rat skeletal muscle using 23880-1-AP (same clone as 23880-1-PBS)

  rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 23880-1-AP (MYOZ3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23880-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 23880-1-AP (same clone as 23880-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 23880-1-AP (MYOZ3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23880-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat skeletal muscle using 23880-1-AP (same clone as 23880-1-PBS)

  rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 23880-1-AP (MYOZ3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23880-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 23880-1-AP (same clone as 23880-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 23880-1-AP (MYOZ3 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 23880-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 23880-1-AP (same clone as 23880-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 23880-1-AP (MYOZ3 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 23880-1-PBS in a different storage buffer formulation.

MYOZ3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 23880-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

23880-1-PBS targets MYOZ3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20839

  Product name: Recombinant human MYOZ3 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-251 aa of BC074870

  Sequence: MIPKEQKGPVMAAMGDLTEPVPTLDLGKKLSVPQDLMMEELSLRNNRGSLLFQKRQRRVQKFTFELAASQRAMLAGSARRKVTGTAESGTVANANGPEGPNYRSELHIFPASPGASLGGPEGAHPAAAPAGCVPSPSALAPGYAEPLKGVPPEKFNHTAIPKGYRCPWQEFVSYRDYQSDGRSHTPSPNDYRNFNKTPVPFGGPLVGGTFPRPGTPFIPEPLSGLELLRLRPSFNRVAQGWVRNLPESEEL

• Full Name: myozenin 3
• Calculated Molecular Weight: 251 aa, 27 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC074870
• Gene Symbol: MYOZ3
• Gene ID (NCBI): 91977
• RRID: AB_2879347
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q8TDC0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.