CoraLite® Plus 488-conjugated Mammaglobin A Monoclonal antibody

Mammaglobin A Monoclonal Antibody for IF/ICC
Cat No. CL488-66237
Clone No.2E5D4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC

Mammaglobin 1, Mammaglobin A, MGB1, SCGB2A2, UGB2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66237 targets Mammaglobin A in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag22485

Product name: Recombinant human SCGB2A2 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-93 aa of BC128252

Sequence: MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF

Predict reactive species
Full Name secretoglobin, family 2A, member 2
Calculated Molecular Weight 93 aa, 10 kDa
GenBank Accession NumberBC128252
Gene Symbol Mammaglobin A
Gene ID (NCBI) 4250
RRIDAB_3084223
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ13296
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Mammaglobin A, also known as SCGB2A2, is a member of the secretoglobin superfamily. Mammaglobin A is a breast cancer-associated antigen almost exclusively over-expressed in primary and metastatic human breast cancers, making it a specific molecular marker and a potential therapeutic target for breast cancer. This monoclonal antibody is raised against full-length of 93-amino acid human mammaglobin A.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Mammaglobin A antibody CL488-66237Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...