• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Moesin Polyclonal antibody

Moesin Polyclonal Antibody for IF/ICC
Cat No. CL488-26053

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

moesin, MSN

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-26053 targets Moesin in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag23531

Product name: Recombinant human MSN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 385-502 aa of BC017293

Sequence: EAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKD

Predict reactive species
Full Name moesin
Calculated Molecular Weight 577 aa, 68 kDa
Observed Molecular Weight 68-70 kDa
GenBank Accession NumberBC017293
Gene Symbol Moesin
Gene ID (NCBI) 4478
RRIDAB_3084095
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP26038
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Moesin belongs to the ezrin-radixin-moesin (ERM) family of proteins which act as cross-linkers between membrane and actin cytoskeleton. ERM proteins provide structural links to strengthen the cell cortex and facilitate several key cellular processes, including membrane dynamics, substrate adhesion, cell survival, cell adhesion, and motility. The function of ERM proteins is highly reliant on phosphorylation induced conformational changes in response to growth factor, chemokine, and antigen stimulation. This antibody may cross-react with ezrin or radixin with molecular weights around 68-70 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Moesin antibody CL488-26053Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...