CoraLite® Plus 750-conjugated NAGS Recombinant monoclonal antibody

NAGS Uni-rAb® Recombinant Antibody for WB, FC (Intra)
Cat No. CL750-82963
Clone No.230279D3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra)

230279D3, AGAS, Amino-acid acetyltransferase, ARGA, EC:2.3.1.1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat liver tissue, mouse liver
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-82963 targets NAGS in WB, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16073

Product name: Recombinant human NAGS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-368 aa of BC111713

Sequence: MDMKPLVVLGLPAPTAPSGCLSFWEAKAQLAKSCKVLVDALRHNAAAAVPFFGGGSVLRAAEPAPHASYGGIVSVETDLLQWCLESGSIPILCPIGETAARRSVLLDSLEVTASLAKALRPTKIIFLNNTGGLRDSSHKVLSNVNLPADLDLVCNAEWVSTKERQQMRLIVDVLSRLPHHSSAVITAASTLLTELFSNKGSGTLFKNAERMLRVRSLDKLDQGRLVDLVNASFGKKLRDDYLASLRPRLHSIYVSEGYNAAAILTMEPVLGGTPYLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSDGSFSNKQWIFFWFGLADIRDSYELVNHAKGLPDSFHKPASDPGS

Predict reactive species
Full Name N-acetylglutamate synthase
Calculated Molecular Weight 534 aa, 58 kDa
Observed Molecular Weight 58 kDa
GenBank Accession NumberBC111713
Gene Symbol NAGS
Gene ID (NCBI) 162417
RRIDAB_3673753
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8N159
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

N-acetylglutamate synthase, also known as NAGS, is a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAGS is the key enzyme for regulating the hepatic urea cycle and is also highly expressed in the kidney and gut. Deficiency of NAGS leads to hyperammonemia due to decreased activity of CPSI deprived of its cofactor NAG(PMID:12459178,12754705).

Protocols

Product Specific Protocols
FC protocol for CL Plus 750 NAGS antibody CL750-82963Download protocol
WB protocol for CL Plus 750 NAGS antibody CL750-82963Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...