Nanog Monoclonal antibody, PBS Only

Nanog Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67255-1-PBS
Clone No.3A2E1

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

WB, Indirect ELISA

hNanog, 3A2E1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67255-1-PBS targets Nanog in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21364

Product name: Recombinant human NANOG protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-305 aa of BC160187

Sequence: MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV

Predict reactive species
Full Name Nanog homeobox
Calculated Molecular Weight 35 kDa
Observed Molecular Weight35-40 kDa
GenBank Accession NumberBC160187
Gene Symbol Nanog
Gene ID (NCBI) 79923
RRIDAB_2882529
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H9S0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Nanog is a member of the homeobox family of DNA binding transcription factors and has been shown to maintain embryonic stem (ES) cell self-renewal independently of leukemia inhibitory factor (LIF)/Stat3. Nanog mRNA is present in pluripotent mouse and human cell lines, and absent from differentiated cells. Functionally, Nanog works together with other key pluripotent factors (Oct4, Sox2, and Lin28) to reprogram human fibroblasts and generate induced pluripotent stem (iPS) cells. These key factors form a regulatory network to support or limit each other's expression level, which maintains the properties of ES cells. Affinity purified rabbit anti-Nanog can be used to demonstrate pluripotency of ES and IPS cells. There are two kinds of variants could recognized by NANOG, one is normal form (~39kd), the other is post-translation modified form (~48kd) (21136380 ). Nanog exists two isoforms with molecular weight 34.4 kDa and 31.9 kDa. (PMID: 21969378)

Loading...
||
New chat Able
正在加载,请稍候...