NAP1L1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NAP1L1 Polyclonal antibody (14898-1-AP)

• Featured Product
• KD/KO Validated

NAP1L1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 14898-1-AP Copied!

Publications (17)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

NAP1, NAP1L, NAP-1-related protein, NRP, Nucleosome assembly protein 1-like 1

• 

  WB analysis using 14898-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14898-1-AP (NAP1L1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14898-1-AP

  WB result of NAP1L1 antibody (14898-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NAP1L1 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 14898-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 14898-1-AP (NAP1L1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HT-1080 using 14898-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 14898-1-AP (NAP1L1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 14898-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 14898-1-AP (NAP1L1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 14898-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 14898-1-AP (NAP1L1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 14898-1-AP

  IP result of anti-NAP1L1 (IP:14898-1-AP, 4ug; Detection:14898-1-AP 1:5000) with HEK-293 cells lysate 1440 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 14898-1-AP (NAP1L1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14898-1-AP (NAP1L1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat spleen using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 14898-1-AP (NAP1L1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 14898-1-AP (NAP1L1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 14898-1-AP (NAP1L1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 14898-1-AP (NAP1L1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 14898-1-AP (NAP1L1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 14898-1-AP (NAP1L1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 14898-1-AP (NAP1L1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 14898-1-AP (NAP1L1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 14898-1-AP (NAP1L1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 14898-1-AP (NAP1L1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 14898-1-AP (NAP1L1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 14898-1-AP (NAP1L1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 14898-1-AP (NAP1L1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 14898-1-AP (NAP1L1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 14898-1-AP (NAP1L1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 14898-1-AP (NAP1L1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 14898-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 14898-1-AP (NAP1L1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 14898-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NAP1L1 antibody (14898-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of NIH/3T3 using 14898-1-AP

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using NAP1L1 antibody (14898-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 14898-1-AP

  Immunofluorescent analysis of HepG2 cells, using NAP1L1 antibody 14898-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of NIH/3T3 using 14898-1-AP

  1x10^6 NIH/3T3 cells were intracellularly stained with 0.25 ug NAP1L1 Polyclonal antibody (14898-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NAP1L1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HL-60 cells, HeLa cells, HEK-293 cells, HT-1080 cells, A431 cells, mouse thymus tissue, Jurkat cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: mouse testis tissue, human heart tissue, human kidney tissue, human placenta tissue, human testis tissue, human skin tissue, human brain tissue, human spleen tissue, human lung tissue, human ovary tissue, rat spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, NIH/3T3 cells
• Positive FC (Intra) detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14898-1-AP targets NAP1L1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6690

  Product name: Recombinant human NAP1L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-391 aa of BC002387

  Sequence: MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ

• Full Name: nucleosome assembly protein 1-like 1
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC002387
• Gene Symbol: NAP1L1
• Gene ID (NCBI): 4673
• RRID: AB_2150696
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P55209
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The NAP1L1 Polyclonal antibody (Cat# 14898-1-AP) has 17 citations. Journals include Signal Transduction and Targeted Therapy, Molecular Cancer, Autophagy, Protein & Cell, Nature Structural & Molecular Biology, Cancer Cell International, Oncotarget, and Journal of Virology. Research fields span cancer (nasopharyngeal, colorectal, breast, liver, melanoma, lung), cardioprotection and cardiac fibrosis, autophagy/mitophagy, stem cell biology, viral infection, reproductive biology, and osteoporosis.

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Signal Transduct Target Ther; Nucleosome assembly protein-like 1 degradation-dependent novel cardioprotection mechanism of Wnt2 against ischemia‒reperfusion injury; Authors - Ying Wang
human	WB	Mol Cancer; NAP1L1 degradation by FBXW7 reduces the deubiquitination of HDGF-p62 signaling to stimulate autophagy and induce primary cisplatin chemosensitivity in nasopharyngeal carcinoma; Authors - Bin Gong ; KD Validated
		Autophagy; Restricting intracellular Salmonella proliferation by coordinating p-TBK1 mediated mitophagy and xenophagy; Authors - Jun Li
human		Protein Cell; CRISPR-assisted transcription activation by phase separation proteins; Authors - Jiaqi Liu
human	WB	J Adv Res; Long noncoding RNA AC007637.1 inhibits tumorigenesis by regulating the Trim25/PCNA axis in colorectal cancer.; Authors - Xue Wang
human	WB	Nat Struct Mol Biol; Mechanism of client selection by the protein quality-control factor UBE2O; Authors - Matthew C J Yip