Filter: AllWBIHCIF

WB analysis using 66088-1-Ig (same clone as 66088-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 66088-1-Ig (NCALD antibody) at dilution of 1:1600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66088-1-PBS in a different storage buffer formulation.
WB analysis using 66088-1-Ig (same clone as 66088-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 66088-1-Ig (NCALD antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66088-1-PBS in a different storage buffer formulation.
WB analysis of human brain using 66088-1-Ig (same clone as 66088-1-PBS)
human brain tissue were subjected to SDS PAGE followed by western blot with 66088-1-Ig (NCALD antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66088-1-PBS in a different storage buffer formulation.
WB analysis using 66088-1-Ig (same clone as 66088-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 66088-1-Ig (NCALD antibody) at dilution of 1:1600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66088-1-PBS in a different storage buffer formulation.
IHC staining of human cerebellum using 66088-1-Ig (same clone as 66088-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cerebellum using 66088-1-Ig(NCALD antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 66088-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 66088-1-Ig (same clone as 66088-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis slide using 66088-1-Ig (NCALD Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 66088-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 66088-1-Ig (same clone as 66088-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis slide using 66088-1-Ig (NCALD Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 66088-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 66088-1-Ig (same clone as 66088-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66088-1-Ig (NCALD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66088-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 66088-1-Ig (same clone as 66088-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66088-1-Ig (NCALD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66088-1-PBS in a different storage buffer formulation.
IHC staining of mouse cerebellum using 66088-1-Ig (same clone as 66088-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 66088-1-Ig (NCALD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66088-1-PBS in a different storage buffer formulation.
IHC staining of mouse cerebellum using 66088-1-Ig (same clone as 66088-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 66088-1-Ig (NCALD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66088-1-PBS in a different storage buffer formulation.
IHC staining of mouse cerebellum using 66088-1-Ig (same clone as 66088-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 66088-1-Ig (NCALD antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66088-1-PBS in a different storage buffer formulation.
IHC staining of mouse cerebellum using 66088-1-Ig (same clone as 66088-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 66088-1-Ig (NCALD antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66088-1-PBS in a different storage buffer formulation.
IHC staining of human cerebellum using 66088-1-Ig (same clone as 66088-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cerebellum using 66088-1-Ig(NCALD antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 66088-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 66088-1-Ig (same clone as 66088-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 66088-1-Ig (NCALD antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66088-1-PBS in a different storage buffer formulation.

NCALD Monoclonal antibody, PBS Only

NCALD Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66088-1-PBS

Clone No.6B4E10

Review Product

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, pig, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

NCALD, neurocalcin delta, neurocalcin δ

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

66088-1-PBS targets NCALD in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, pig, rat samples.

Tested Reactivity	human, mouse, pig, rat
Host / Isotype	Mouse / IgG2a
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag18760 Product name: Recombinant human NCALD protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-193 aa of BC036098 Sequence: MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNRDGKLSMEEFIRGAKSDPSIVRLLQCDPSSAGQF Predict reactive species
Full Name	neurocalcin delta
Calculated Molecular Weight	193 aa, 22 kDa
Observed Molecular Weight	22 kDa
GenBank Accession Number	BC036098
Gene Symbol	NCALD
Gene ID (NCBI)	83988
RRID	AB_11232229
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P61601
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

NCALD(Neurocalcin-delta) is a member of the EF-hand calcium-binding protein superfamily.It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation.It is a high-affinity Ca2+ sensor (Kd of approx. 0.6 uM), which is most abundantly expressed in the Purkinje cells of the cerebellum(PMID:11964161).This antibody is specific to NCALD.