NCALD Monoclonal antibody

• 

  WB analysis using 66088-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66088-1-Ig (NCALD antibody) at dilution of 1:1600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 66088-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66088-1-Ig (NCALD antibody) at dilution of 1:1600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 66088-1-Ig

  human brain tissue were subjected to SDS PAGE followed by western blot with 66088-1-Ig (NCALD antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 66088-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66088-1-Ig (NCALD antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cerebellum using 66088-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cerebellum using 66088-1-Ig(NCALD antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of mouse brain using 66088-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66088-1-Ig (NCALD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 66088-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66088-1-Ig (NCALD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 66088-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 66088-1-Ig (NCALD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 66088-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 66088-1-Ig (NCALD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 66088-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 66088-1-Ig (NCALD antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 66088-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 66088-1-Ig (NCALD antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cerebellum using 66088-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cerebellum using 66088-1-Ig(NCALD antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 66088-1-Ig

  Immunohistochemical analysis of paraffin-embedded human testis slide using 66088-1-Ig (NCALD Antibody) at dilution of 1:50.

• 

  IHC staining of human testis using 66088-1-Ig

  Immunohistochemical analysis of paraffin-embedded human testis slide using 66088-1-Ig (NCALD Antibody) at dilution of 1:50.

• 

  IF Staining of HeLa using 66088-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 66088-1-Ig (NCALD antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated Goat Anti-Mouse IgG(H+L).

NCALD Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66088-1-Ig

Clone No.6B4E10

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, pig, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

NCALD, neurocalcin delta, neurocalcin δ

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, human brain tissue, pig cerebellum tissue, pig brain tissue, rat brain tissue, mouse brain tissue, rat cerebellum tissue, mouse cerebellum tissue
• Positive IHC detected in: human cerebellum tissue, mouse cerebellum tissue, human testis tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3200
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66088-1-Ig targets NCALD in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, pig, rat samples.

• Tested Reactivity: human, mouse, pig, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18760

  Product name: Recombinant human NCALD protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-193 aa of BC036098

  Sequence: MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNRDGKLSMEEFIRGAKSDPSIVRLLQCDPSSAGQF

• Full Name: neurocalcin delta
• Calculated Molecular Weight: 193 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC036098
• Gene Symbol: NCALD
• Gene ID (NCBI): 83988
• RRID: AB_11232229
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P61601
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NCALD(Neurocalcin-delta) is a member of the EF-hand calcium-binding protein superfamily.It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation.It is a high-affinity Ca2+ sensor (Kd of approx. 0.6 uM), which is most abundantly expressed in the Purkinje cells of the cerebellum(PMID:11964161).This antibody is specific to NCALD.