NCALD Monoclonal antibody

NCALD Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66088-1-Ig

Clone No. 6B4E10

Publications (1)

Review Product

Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, pig, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

NCALD, neurocalcin delta, neurocalcin δ

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488 CoraLite®594

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis using 66088-1-Ig
Various lysates were subjected to SDS PAGE followed by western blot with 66088-1-Ig (NCALD antibody) at dilution of 1:1600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human brain using 66088-1-Ig
human brain tissue were subjected to SDS PAGE followed by western blot with 66088-1-Ig (NCALD antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 66088-1-Ig
Various lysates were subjected to SDS PAGE followed by western blot with 66088-1-Ig (NCALD antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 66088-1-Ig
Various lysates were subjected to SDS PAGE followed by western blot with 66088-1-Ig (NCALD antibody) at dilution of 1:1600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human cerebellum using 66088-1-Ig
Immunohistochemical analysis of paraffin-embedded human cerebellum using 66088-1-Ig(NCALD antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human testis using 66088-1-Ig
Immunohistochemical analysis of paraffin-embedded human testis slide using 66088-1-Ig (NCALD Antibody) at dilution of 1:50.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human testis using 66088-1-Ig
Immunohistochemical analysis of paraffin-embedded human testis slide using 66088-1-Ig (NCALD Antibody) at dilution of 1:50.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 66088-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66088-1-Ig (NCALD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 66088-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66088-1-Ig (NCALD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse cerebellum using 66088-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 66088-1-Ig (NCALD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse cerebellum using 66088-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 66088-1-Ig (NCALD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse cerebellum using 66088-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 66088-1-Ig (NCALD antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse cerebellum using 66088-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 66088-1-Ig (NCALD antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human cerebellum using 66088-1-Ig
Immunohistochemical analysis of paraffin-embedded human cerebellum using 66088-1-Ig(NCALD antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 66088-1-Ig
Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 66088-1-Ig (NCALD antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated Goat Anti-Mouse IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NCALD in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	fetal human brain tissue, human brain tissue, pig cerebellum tissue, pig brain tissue, rat brain tissue, mouse brain tissue, rat cerebellum tissue, mouse cerebellum tissue
Positive IHC detected in	human cerebellum tissue, mouse cerebellum tissue, human testis tissue, mouse brain tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:3200
Immunohistochemistry (IHC)	IHC : 1:20-1:200
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66088-1-Ig targets NCALD in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, pig, rat samples.

Tested Reactivity	human, mouse, pig, rat
Cited Reactivity	human
Host / Isotype	Mouse / IgG2a
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag18760 Product name: Recombinant human NCALD protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-193 aa of BC036098 Sequence: MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNRDGKLSMEEFIRGAKSDPSIVRLLQCDPSSAGQF Predict reactive species
Full Name	neurocalcin delta
Calculated Molecular Weight	193 aa, 22 kDa
Observed Molecular Weight	22 kDa
GenBank Accession Number	BC036098
Gene Symbol	NCALD
Gene ID (NCBI)	83988
RRID	AB_11232229
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P61601
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NCALD(Neurocalcin-delta) is a member of the EF-hand calcium-binding protein superfamily.It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation.It is a high-affinity Ca2+ sensor (Kd of approx. 0.6 uM), which is most abundantly expressed in the Purkinje cells of the cerebellum(PMID:11964161).This antibody is specific to NCALD.

Protocols

Product Specific Protocols
IF protocol for NCALD antibody 66088-1-Ig	Download protocol
IHC protocol for NCALD antibody 66088-1-Ig	Download protocol
WB protocol for NCALD antibody 66088-1-Ig	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The NCALD Monoclonal antibody (6B4E10), catalog number 66088-1-Ig, has 1 citation. It appears in Journal of Oral Pathology and Medicine (2026), where it was used for IHC in a study on elevated N6-methyladenosine (m6A) RNA methylation during oral carcinogenesis. The research field is oral oncology and RNA epigenetics.