• Featured Product
  • KD/KO Validated

Cardinal Red™-conjugated Nucleolin/C23 Polyclonal antibody

Nucleolin/C23 Polyclonal Antibody for
Cat No. CR-10556

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

nucleolin, C23, Protein C23, NCL, FLJ45706

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Cardinal Red™
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CR-10556 targets Nucleolin/C23 in applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0859

Product name: Recombinant human NCL protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-482 aa of BC006494

Sequence: MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE

Predict reactive species
Full Name nucleolin
Calculated Molecular Weight 76 kDa
Observed Molecular Weight 100-110 kDa
GenBank Accession NumberBC006494
Gene Symbol NCL
Gene ID (NCBI) 4691
Conjugate Cardinal Red™ Fluorescent Dye
Excitation/Emission Maxima Wavelengths592 nm / 611 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP19338
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Nucleolin, also known as C23, involved in the control of transcription of ribosomal RNA (rRNA) genes by RNA polymerase I, in nucleocytoplasmic transportation of ribosomal components, and in ribosome maturation and assembly. It associated with intranucleolar chromatin and pre-ribosomal particles, and induced chromatin decondensation by binding to histione H1. Also it has a role in the process of transcriptional elongation. Whilst mammalian nucleolin has a predicted molecular mass of approximately 77 kDa, the apparent molecular mass is between 100 and 110 kDa, and has been attributed to the amino acid composition of the N-terminal domain, which is highly phosphorylated. (PMID: 15925566)

Loading...
||
New chat Able
正在加载,请稍候...