Home
Products
Primary Antibodies
NDUFS6 Polyclonal antibody, PBS Only (14417-1-PBS)

Filter: AllWBIPIHCIF/ICC

WB analysis using 14417-1-AP (same clone as 14417-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 14417-1-AP (NDUFS6 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14417-1-PBS in a different storage buffer formulation.
WB analysis using 14417-1-AP (same clone as 14417-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 14417-1-AP (NDUFS6 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14417-1-PBS in a different storage buffer formulation.
WB analysis of rat liver using 14417-1-AP (same clone as 14417-1-PBS)
rat liver tissue were subjected to SDS PAGE followed by western blot with 14417-1-AP (NDUFS6 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14417-1-PBS in a different storage buffer formulation.
WB analysis of human heart using 14417-1-AP (same clone as 14417-1-PBS)
human heart tissue were subjected to SDS PAGE followed by western blot with 14417-1-AP (NDUFS6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14417-1-PBS in a different storage buffer formulation.
WB analysis of human liver using 14417-1-AP (same clone as 14417-1-PBS)
human liver tissue were subjected to SDS PAGE followed by western blot with 14417-1-AP (NDUFS6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14417-1-PBS in a different storage buffer formulation.
IP experiment of mouse liver using 14417-1-AP (same clone as 14417-1-PBS)
IP result of anti-NDUFS6 (IP:14417-1-AP, 4ug; Detection:14417-1-AP 1:300) with mouse liver tissue lysate 3200 ug. This data was developed using the same antibody clone with 14417-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 14417-1-AP (same clone as 14417-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14417-1-AP (NDUFS6 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14417-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 14417-1-AP (same clone as 14417-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14417-1-AP (NDUFS6 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14417-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 14417-1-AP (same clone as 14417-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using NDUFS6 antibody (14417-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 14417-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 14417-1-AP (same clone as 14417-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NDUFS6 antibody (14417-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 14417-1-PBS in a different storage buffer formulation.

NDUFS6 Polyclonal antibody, PBS Only

Name: NDUFS6 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 14417-1-PBS

NDUFS6 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 14417-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

CI 13kD A, CI-13kD-A, Complex I 13kD A, Complex I-13kD-A, NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

14417-1-PBS targets NDUFS6 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag5762 Product name: Recombinant human NDUFS6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-124 aa of BC046155 Sequence: MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH Predict reactive species
Full Name	NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase)
Calculated Molecular Weight	14 kDa
Observed Molecular Weight	13 kDa
GenBank Accession Number	BC046155
Gene Symbol	NDUFS6
Gene ID (NCBI)	4726
RRID	AB_2149024
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O75380
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

NDUFS6(NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial) is also named as 1CI-13kD-A, NADH-ubiquinone oxidoreductase 13 kDa-A subunit and belongs to the complex I NDUFS6 subunit family.It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.