NDUFS7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NDUFS7 Polyclonal antibody, PBS Only (15728-1-PBS)

• 

  WB analysis of A549 using 15728-1-AP (same clone as 15728-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 15728-1-AP (NDUFS7 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15728-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 15728-1-AP (same clone as 15728-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 15728-1-AP (NDUFS7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15728-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 15728-1-AP (same clone as 15728-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 15728-1-AP (NDUFS7 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 15728-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 15728-1-AP (same clone as 15728-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 15728-1-AP (NDUFS7 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 15728-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 15728-1-AP (same clone as 15728-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using NDUFS7 antibody (15728-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 15728-1-PBS in a different storage buffer formulation.

NDUFS7 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 15728-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

15728-1-PBS targets NDUFS7 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8471

  Product name: Recombinant human NDUFS7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-213 aa of BC005954

  Sequence: MAVLSAPGLRGFRILGLRSSVGLAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR

• Full Name: NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase)
• Calculated Molecular Weight: 213 aa, 24 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC005954
• Gene Symbol: NDUFS7
• Gene ID (NCBI): 374291
• RRID: AB_2149029
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75251
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NDUFS7(NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial) protein is one of the most conserved subunits of mitochondrial respiratory chain complex I and plays a central role in the interaction with the electron acceptor ubiquinone and in the proton-translocating mechanism(PMID:15269216).Defects in NDUFS7 are a cause of Leigh syndrome (LS) and mitochondrial complex I deficiency (MT-C1D).