NEDD4L Monoclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 67276-1-Ig (same clone as 67276-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67276-1-Ig (NEDD4L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67276-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 67276-1-Ig (same clone as 67276-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67276-1-Ig (NEDD4L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67276-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67276-1-Ig (same clone as 67276-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67276-1-Ig (NEDD4L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67276-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 67276-1-Ig (same clone as 67276-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 67276-1-Ig (NEDD4L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67276-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 67276-1-Ig (same clone as 67276-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed PC-3 cells using NEDD4L antibody (67276-1-Ig, Clone: 2F6H6 ) at dilution of 1:3000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67276-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 67276-1-Ig (same clone as 67276-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using NEDD4L antibody (67276-1-Ig, Clone: 2F6H6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67276-1-PBS in a different storage buffer formulation.

NEDD4L Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67276-1-PBS

Clone No.2F6H6

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

KIAA0439, hNEDD4-2, HECT-type E3 ubiquitin transferase NED4L, EC:2.3.2.26, E3 ubiquitin-protein ligase NEDD4-like

---

Product Information

67276-1-PBS targets NEDD4L in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4565

  Product name: Recombinant human NEDD4L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 565-911 aa of BC032597

  Sequence: EESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD

• Full Name: neural precursor cell expressed, developmentally down-regulated 4-like
• Calculated Molecular Weight: 854 aa, 96 kDa
• Observed Molecular Weight: 112 kDa, 125 kDa
• GenBank Accession Number: BC032597
• Gene Symbol: NEDD4L
• Gene ID (NCBI): 23327
• RRID: AB_2882545
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q96PU5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NEDD4L(E3 ubiquitin-protein ligase NEDD4-like) is also named as KIAA0439, NEDL3, Nedd4-2. It accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substratesand and is the principal ubiquitin ligase that selectively targets activated SMAD2 and SMAD3 for destruction (PMID:19917253). Nedd4L binds the PY motif of ENaC COOH terminals and catalyzes ubiquitination of the NH2 terminus of the protein for subsequent degradation (PMID:18268134). It has some isoforms produced by alternative splicing. This antibody may have cross reaction with NEDD4 due to the high homology of the antigen.