NEDD4L Monoclonal antibody, PBS Only

NEDD4L Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 67276-1-PBS
Clone No.2F6H6

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, IF/ICC, Indirect ELISA

KIAA0439, hNEDD4-2, HECT-type E3 ubiquitin transferase NED4L, EC:2.3.2.26, E3 ubiquitin-protein ligase NEDD4-like

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67276-1-PBS targets NEDD4L in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4565

Product name: Recombinant human NEDD4L protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 565-911 aa of BC032597

Sequence: EESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD

Predict reactive species
Full Name neural precursor cell expressed, developmentally down-regulated 4-like
Calculated Molecular Weight 854 aa, 96 kDa
Observed Molecular Weight 112 kDa, 125 kDa
GenBank Accession NumberBC032597
Gene Symbol NEDD4L
Gene ID (NCBI) 23327
RRIDAB_2882545
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ96PU5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NEDD4L(E3 ubiquitin-protein ligase NEDD4-like) is also named as KIAA0439, NEDL3, Nedd4-2. It accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substratesand and is the principal ubiquitin ligase that selectively targets activated SMAD2 and SMAD3 for destruction (PMID:19917253). Nedd4L binds the PY motif of ENaC COOH terminals and catalyzes ubiquitination of the NH2 terminus of the protein for subsequent degradation (PMID:18268134). It has some isoforms produced by alternative splicing. This antibody may have cross reaction with NEDD4 due to the high homology of the antigen.

Loading...
||
New chat Able
正在加载,请稍候...