NEK7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NEK7 Polyclonal antibody, PBS Only (31422-1-PBS)

• 

  WB analysis using 31422-1-AP (same clone as 31422-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31422-1-AP (NEK7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31422-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 31422-1-AP (same clone as 31422-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31422-1-AP (NEK7 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31422-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 31422-1-AP (same clone as 31422-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 31422-1-AP (NEK7 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31422-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 31422-1-AP (same clone as 31422-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 31422-1-AP (NEK7 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31422-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 31422-1-AP (same clone as 31422-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 31422-1-AP (NEK7 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31422-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 31422-1-AP (same clone as 31422-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 31422-1-AP (NEK7 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31422-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 31422-1-AP (same clone as 31422-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NEK7 antibody (31422-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 31422-1-PBS in a different storage buffer formulation.

NEK7 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 31422-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

NimA related protein kinase 7

---

Product Information

31422-1-PBS targets NEK7 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33629

  Product name: Recombinant human NEK7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-36 aa of NM_133494

  Sequence: MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRI

• Full Name: NIMA (never in mitosis gene a)-related kinase 7
• Calculated Molecular Weight: 35
• Observed Molecular Weight: 32-35 kDa
• GenBank Accession Number: NM_133494
• Gene Symbol: NEK7
• Gene ID (NCBI): 140609
• RRID: AB_3669975
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8TDX7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mammalian NIMA-related kinases (NEKs) represent a family of serine/threonine kinases, named NEK1-NEK11, which are implicated in the control of several aspects of mitosis and are involved in non-mitotic functions (PMID: 33364979). NIMA-related kinase 7 (NEK7) is the smallest NIMA-related kinase (NEK) in mammals. NEK7 is identified as a highly conserved serine or threonine kinase, which is not only crucial for mitosis entry, cell cycle progression, cell division, and mitotic process, but also expressed in brain, heart, lung, liver, spleen, and other issues (PMID: 31787755).