NET1 Polyclonal antibody, PBS Only

• 

  WB analysis using 28180-1-AP (same clone as 28180-1-PBS)

  Y79 cells were subjected to SDS PAGE followed by western blot with 28180-1-AP (NET1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28180-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 28180-1-AP (same clone as 28180-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 28180-1-AP (NET1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28180-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 28180-1-AP (same clone as 28180-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 28180-1-AP (NET1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28180-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 28180-1-AP (same clone as 28180-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28180-1-AP (NET1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28180-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 28180-1-AP (same clone as 28180-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28180-1-AP (NET1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28180-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 28180-1-AP (same clone as 28180-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using NET1 antibody (28180-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28180-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NET1 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 28180-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

---

Product Information

28180-1-PBS targets NET1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28142

  Product name: Recombinant human NET1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 442-542 aa of BC010285

  Sequence: IRAAIAPFQSAGSPPELQGLPELHEECEGNHPSARKLTAQRRASTVSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETLV

• Full Name: neuroepithelial cell transforming 1
• Calculated Molecular Weight: 596 aa, 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC010285
• Gene Symbol: NET1
• Gene ID (NCBI): 10276
• RRID: AB_2881082
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z628
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.