NEU3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NEU3 Polyclonal antibody, PBS Only (27879-1-PBS)

• 

  WB analysis using 27879-1-AP (same clone as 27879-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27879-1-AP (NEU3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27879-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 27879-1-AP (same clone as 27879-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27879-1-AP (NEU3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27879-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 27879-1-AP (same clone as 27879-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 27879-1-AP (NEU3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27879-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 27879-1-AP (same clone as 27879-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27879-1-AP (NEU3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27879-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse small intestine using 27879-1-AP (same clone as 27879-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse small intestine tissue using NEU3 antibody (27879-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27879-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NEU3 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 27879-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

---

Product Information

27879-1-PBS targets NEU3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27259

  Product name: Recombinant human NEU3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 193-326 aa of NM_006656.5

  Sequence: MPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSE

• Full Name: sialidase 3 (membrane sialidase)
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48, 52 kDa
• GenBank Accession Number: NM_006656.5
• Gene Symbol: NEU3
• Gene ID (NCBI): 10825
• RRID: AB_2881002
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UQ49
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.