NFKBIZ Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NFKBIZ Polyclonal antibody, PBS Only (14014-1-PBS)

• 

  WB analysis of HeLa using 14014-1-AP (same clone as 14014-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 14014-1-AP (NFKBIZ antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14014-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14014-1-AP (same clone as 14014-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14014-1-AP (NFKBIZ antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14014-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 14014-1-AP (same clone as 14014-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 14014-1-AP (NFKBIZ Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 14014-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 14014-1-AP (same clone as 14014-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 14014-1-AP (NFKBIZ Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14014-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 14014-1-AP (same clone as 14014-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NFKBIZ antibody (14014-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 14014-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NFKBIZ Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 14014-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

14014-1-PBS targets NFKBIZ in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5120

  Product name: Recombinant human NFKBIZ protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 369-718 aa of BC060800

  Sequence: AHLHSFSMMPSSACEAMVGHEMASDSSNTSLPFSNMGNPMNTTQLGKSLFQWQVEQEESKLANISQDQFLSKDADGDTFLHIAVAQGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLLKNKSLVDTIKCLIQMGAAVEAKDRKSGRTALHLAAEEANLELIRLFLELPSCLSFVNAKAYNGNTALHVAASLQYRLTQLDAVRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY

• Full Name: nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta
• Calculated Molecular Weight: 78 kDa
• Observed Molecular Weight: 78 kDa, 64 kDa
• GenBank Accession Number: BC060800
• Gene Symbol: NFKBIZ
• Gene ID (NCBI): 64332
• RRID: AB_2878000
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BYH8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NFKBIZ, also named as NF-kappa-B inhibitor zeta, is a 718 amino acid protein, which contains 7 ANK repeats and is expressed at high levels in peripheral blood leukocytes and lung, at moderate levels in liver, placenta, and at low levels in spleen, kidney, skeletal muscle and heart. NFKBIZ exists as three isoforms and molecular weight of isoform three is a 64 kDa. The isoform one is 78 kDa protein and isoform two is a 68 kDa protein. NFKBIZ is involved in regulation of NF-kappa-B transcription factor complexes. It Inhibits NF-kappa-B activity without affecting its nuclear translocation upon stimulation.