CoraLite® Plus 488-conjugated NME2 Recombinant monoclonal antibody

NME2 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-85074-4
Clone No.242698C3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

242698C3, C-myc purine-binding transcription factor PUF, EC:2.7.13.3, EC:2.7.4.6, Histidine protein kinase NDKB

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85074-4 targets NME2 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13913

Product name: Recombinant human NME2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-152 aa of BC002476

Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

Predict reactive species
Full Name non-metastatic cells 2, protein (NM23B) expressed in
Calculated Molecular Weight 152 aa, 17 kDa
Observed Molecular Weight 17 kDa
GenBank Accession NumberBC002476
Gene Symbol NME2
Gene ID (NCBI) 4831
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP22392
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NME2(non-metastatic cells 2, protein) is also named as NDKB(Nucleoside diphosphate kinase B), NM23B and belongs to the NDK family. It is involved in the phosphorylation of nucleoside diphosphates and interacts with membrane receptor and constituting a novel molecular regulatory mechanism of GPCR endocytosis. This protein has 2 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 NME2 antibody CL488-85074-4Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...