Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated NME3 Recombinant monoclonal antibody

NME3 Uni-rAb® Recombinant Antibody for IF/ICC

Cat No. CL488-84278-5
Clone No.241585H7

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

IF/ICC

241585H7, DR nm23, DR-nm23, EC:2.7.4.6, KIAA0516

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84278-5 targets NME3 in IF/ICC applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7284

Product name: Recombinant human NME3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 22-169 aa of BC000250

Sequence: ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE

Predict reactive species
Full Name non-metastatic cells 3, protein expressed in
Calculated Molecular Weight 19 kDa
Observed Molecular Weight 18 kDa
GenBank Accession NumberBC000250
Gene Symbol NME3
Gene ID (NCBI) 4832
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13232
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NME3 (NME/NM23 Nucleoside Diphosphate Kinase 3), also named as NM23-H3; DR-NM23, is a member of the nucleoside diphosphate kinase (NDPK) family that binds to the mitochondrial outer membrane to stimulate mitochondrial fusion. The depletion of NME3 will cause dysfunction in mitochondrial dynamics. NME3 has been found to facilitate DNA-repair mechanisms binds to several NPHPs, including NEK8, CEP164, and ankyrin repeat and sterile α motif domain-containing 6 (ANKS6)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 NME3 antibody CL488-84278-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...