NNMT Recombinant monoclonal antibody

NNMT Uni-rAb® Recombinant Antibody for WB, FC (Intra), IP, ELISA

Cat No. 84876-5-RR
Clone No.242394B7

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, FC (Intra), IP, ELISA

242394B7, EC:2.1.1.1, Nicotinamide N-methyltransferase

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inL02 cells, SGC-7901 cells, rat liver tissue
Positive IP detected inL02 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84876-5-RR targets NNMT in WB, FC (Intra), IP, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7197

Product name: Recombinant human NNMT protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-264 aa of BC000234

Sequence: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL

Predict reactive species
Full Name nicotinamide N-methyltransferase
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC000234
Gene Symbol NNMT
Gene ID (NCBI) 4837
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP40261
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NNMT can catalyze the N-methylation of nicotinamide using the universal methyl donor S-adenosyl-L-methionine to form N1-methylnicotinamide and S-adenosyl-L-homocysteine, a predominant nicotinamide/vitamin B3 clearance pathway (PMID: 21823666; 23455543; 8182091). It plays a central role in regulating cellular methylation potential, by consuming S-adenosyl-L-methionine and limiting its availability for other methyltransferases. Actively mediates genome-wide epigenetic and transcriptional changes through hypomethylation of repressive chromatin marks, such as H3K27me3 (PMID: 23455543; PMID: 26571212; PMID: 31043742).

Protocols

Product Specific Protocols
WB protocol for NNMT antibody 84876-5-RRDownload protocol
IP protocol for NNMT antibody 84876-5-RRDownload protocol
FC protocol for NNMT antibody 84876-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...