• KD/KO Validated

CoraLite® Plus 488-conjugated NOP58 Recombinant monoclonal antibody

NOP58 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)

Cat No. CL488-82879
Clone No.230058C7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

Nucleolar protein 5, NOP5/NOP58, NOP5, NOL5, HSPC120

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inU2OS cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82879 targets NOP58 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5740

Product name: Recombinant human NOP58 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 279-529 aa of BC032592

Sequence: MMAIAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKRGKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED

Predict reactive species
Full Name NOP58 ribonucleoprotein homolog (yeast)
Calculated Molecular Weight 60 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC032592
Gene Symbol NOP58
Gene ID (NCBI) 51602
RRIDAB_3673094
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y2X3
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The box C/D snoRNPs are named for the short, conserved box C (UGAUGA) and box D (CUGA) sequences present in their RNA moiety. The box C/D sequences are also required for multiple aspects. of snoRNA biogenesis, including RNA stability, intronic processing, nucleolar targeting, nuclear retention, and 59 trimethylguanosine cap formation (PMID:9649444,8878486). Nop58 is a component common to the box C/D small nucleolar ribonucleoprotein (PMID:10606270).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 NOP58 antibody CL488-82879Download protocol
IF protocol for CL Plus 488 NOP58 antibody CL488-82879Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...