CoraLite® Plus 488-conjugated NOX2 Recombinant monoclonal antibody

NOX2 Uni-rAb® Recombinant Antibody for IF-P
Cat No. CL488-82872
Clone No.1B17

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

CYBB, CGD, CGD91-phox, Cytochrome b-245 heavy chain, EC:1.-.-.-

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse spleen tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82872 targets NOX2 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4402

Product name: Recombinant human CYBB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 418-570 aa of BC032720

Sequence: SILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF

Predict reactive species
Full Name cytochrome b-245, beta polypeptide
Calculated Molecular Weight 577 aa, 65 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC032720
Gene Symbol NOX2
Gene ID (NCBI) 1536
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04839
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NOX2, also named as CYBB, CGD, 91-phox, gp91-1, gp91-phox, p22 phagocyte B-cytochrome, cytochrome b-245 and beta polypeptide, is a critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. This full length protein has three glycosylation sites. CYBB is found in human cardiomyocytes as multiple bands:the signal between 55 and 65 kDa is probably the unglycosylated protein, because the predicted molecular weight of unglycosylated CYBB protein is approximately 58 kDa(PMID: 17587483) to 65 kDa in phagocytes and the bands around 80 kDa probably represent glycosylated CYBB, as has also been shown in human umbilical vein endothelial cells(PMID:12610097). In other reports, it also can be detected a band of 91 kDa(PMID:19965781).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 NOX2 antibody CL488-82872Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...