NPHP5/IQCB1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NPHP5/IQCB1 Polyclonal antibody, PBS Only (15747-1-PBS)

• 

  WB analysis using 15747-1-AP (same clone as 15747-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15747-1-AP (NPHP5,IQCB1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15747-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15747-1-AP (same clone as 15747-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15747-1-AP (NPHP5/IQCB1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15747-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 15747-1-AP (same clone as 15747-1-PBS)

  IP result of anti-NPHP5/IQCB1 (IP:15747-1-AP, 4ug; Detection:15747-1-AP 1:1000) with HEK-293 cells lysate 1280 ug. This data was developed using the same antibody clone with 15747-1-PBS in a different storage buffer formulation.

NPHP5/IQCB1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 15747-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

IQCB1, NPHP5, IQ calmodulin-binding motif-containing protein 1, IQ motif containing B1, IQCB 1

---

Product Information

15747-1-PBS targets NPHP5/IQCB1 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8203

  Product name: Recombinant human NPHP5,IQCB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC005806

  Sequence: MKPTGTDPRILSIAAEVAKSPEQNVPVILLKLKEIINITPLGSSELKKIKQDIYCYDLIQYCLLVLSQDYSRIQGGWTTISQLTQILSHCCVGLEPGEDAEEFYNELLPSAAENFLVLGRQLQTCFINAAKAEEKDELLHFFQIVTDSLFWLLGGHVELIQNVLQSDHFLHLLQADNVQIGSAVMMMLQNILQINRSKRSKMLLEINRQKEEEDLKLQLQLQRQRAMRLSRELQLSMLEIVHPGQVEKHYREMEEKSALIIQKHWRGYRERKNFHQQRQSLIEYKAAVTLQRAALKFLAKYRKKKKLFAPWRGLQELTDARRVELKKRVDDYVRRHLGSPMSDVVSRELH

• Full Name: IQ motif containing B1
• Calculated Molecular Weight: 598 aa, 69 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC005806
• Gene Symbol: IQCB1
• Gene ID (NCBI): 9657
• RRID: AB_2878179
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15051
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IQCB1, also known as NPHP5, is a nephrocystin protein that interacts with calmodulin and the retinitis pigmentosa GTPase regulator protein. It has a central coiled-coil region and two calmodulin-binding IQ domains. Localized to the primary cilia of renal epithelial cells and connecting cilia of photoreceptor cells, IQCB1 is thought to play a role in ciliary function. Mutations in this gene result in Senior-Loken syndrome type 5, a juvenile disorder characterized by defects in the waste filtering system of the kidney, as well as retinal degradation.