NPPC Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NPPC Polyclonal antibody, PBS Only (29352-1-PBS)

• 

  IHC staining of rat heart using 29352-1-AP (same clone as 29352-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 29352-1-AP (NPPC antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29352-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 29352-1-AP (same clone as 29352-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 29352-1-AP (NPPC antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29352-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 29352-1-AP (same clone as 29352-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using NPPC antibody (29352-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29352-1-PBS in a different storage buffer formulation.

NPPC Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 29352-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, Indirect ELISA

Synonyms

C type natriuretic peptide, CNP, CNP2

---

Product Information

29352-1-PBS targets NPPC in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29609

  Product name: Recombinant human NPPC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 74-126 aa of NM_024409

  Sequence: DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC

• Full Name: natriuretic peptide precursor C
• Calculated Molecular Weight: 13 kDa
• GenBank Accession Number: NM_024409
• Gene Symbol: NPPC
• Gene ID (NCBI): 4880
• RRID: AB_3742310
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P23582
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NPPC (C-type natriuretic peptide) is also named as CNP2, and belongs to the natriuretic peptide family. More recent studies have shown that in growing and preovulatory follicles, granulosa cells secrete into the follicular fluid, a C-type natriuretic peptide (NPPC, also known as CNP) capable of binding to cumulus cells membrane natriuretic peptide receptor 2 (NPR2, also known as guanylate cyclase B). The CNP/NPR2 complex, acting actively as guanylate cyclase, increases the concentration of cGMP both in cumulus cells and, indirectly, in the oocyte, maintaining meiosis arrest. The cAMP level is maintained due to the upstream activity type C natriuretic peptide (CNP, NPPC), produced by the granulosa cells, which is responsible for the production of cyclic guanosine monophosphate (cGMP) after binding to a specific NPR2 receptor (PMID: 35209923, PMID: 25183874, PMID: 20947764).