• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Nurr1/NR4A2 Monoclonal antibody

Nurr1/NR4A2 Monoclonal Antibody for FC (Intra)
Cat No. CL488-66878
Clone No.1H5B4

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse

Applications

FC (Intra)

HZF 3, NOT, NR4A2, NURR1, Nurr1/NR4A2, Orphan nuclear receptor NURR1, RNR1, TINUR

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells
Positive FC detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66878 targets Nurr1/NR4A2 in FC (Intra) applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1418

Product name: Recombinant human NR4A2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 250-598 aa of BC009288

Sequence: SPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF

Predict reactive species
Full Name nuclear receptor subfamily 4, group A, member 2
Calculated Molecular Weight 66 kDa
Observed Molecular Weight 67 kDa
GenBank Accession NumberBC009288
Gene Symbol Nurr1
Gene ID (NCBI) 4929
RRIDAB_2934503
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP43354
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NR4A2 belongs to the orphan nuclear receptor (NR) family referred to as NR4A family, which have been implicated in cell cycle regulation, apoptosis, inflammation, metabolism and more recently in carcinogenesis [PMID:22583411]. NR4A2 also has a role in the expression of several proteins that are necessary for the synthesis and regulation of DA, such as tyrosine hidroxilase, DA transporter, vesicular monoamine transporter 2, and cRET [PMID:22294735]. Act as a transcriptional regulator, NR4A2 is essential for the differentiation and maintenance of meso-diencephalic mdDA neurons during development. It is crucial for expression of a set of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons [PMID: 17184956].

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Nurr1/NR4A2 antibody CL488-66878Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...