NR5A2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NR5A2 Polyclonal antibody, PBS Only (22460-1-PBS)

• 

  WB analysis using 22460-1-AP (same clone as 22460-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22460-1-AP (NR5A2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22460-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse ovary using 22460-1-AP (same clone as 22460-1-PBS)

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 22460-1-AP (NR5A2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22460-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat testis using 22460-1-AP (same clone as 22460-1-PBS)

  rat testis tissue were subjected to SDS PAGE followed by western blot with 22460-1-AP (NR5A2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22460-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NR5A2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 22460-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

22460-1-PBS targets NR5A2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18001

  Product name: Recombinant human NR5A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 143-332 aa of BC118652

  Sequence: NGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLL

• Full Name: nuclear receptor subfamily 5, group A, member 2
• Calculated Molecular Weight: 541 aa, 61 kDa
• Observed Molecular Weight: 61-67 kDa
• GenBank Accession Number: BC118652
• Gene Symbol: NR5A2
• Gene ID (NCBI): 2494
• RRID: AB_2879108
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: O00482
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NR5A2 belongs to the nuclear hormone receptor family NR5 subfamily.It binds to the sequence element 5'-AACGACCGACCTTGAG-3' of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation.NR5A2 may be responsible for the liver-specific activity of enhancer II, probably in combination with other hepatocyte transcription factors. Key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. It may also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development. LRH-1 is phosphorylated to display its normal function, including its role in the intriguing potential responses to phospholipid or other ligands. The hinge domain serine residues at 238 and 243 are required for effective phosphorylation, both in vitro and in cells (16439367).NR5A1 is abundantly expressed in pancreas, less in liver, very low levels in heart and lung. Expressed in hepG2. Isoform 1 and isoform 2 seem to be present in fetal and adult liver and hepG2 cells.The observed molecular weight of 65-70 kDa is the posphorylation of NR5A2 protein.