CoraLite® Plus 488-conjugated NRCAM Monoclonal antibody

NRCAM Monoclonal Antibody for IF/ICC
Cat No. CL488-68291
Clone No.2E1C3

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Mouse, Rat, Pig

Applications

IF/ICC

hBravo, KIAA0343, Neuronal surface protein Bravo, Ng CAM related, Nr CAM, NRCAM

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68291 targets NRCAM in IF/ICC applications and shows reactivity with Human, Mouse, Rat, Pig samples.

Tested Reactivity Human, Mouse, Rat, Pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20558

Product name: Recombinant human NRCAM protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 446-628 aa of BC098401

Sequence: EPPRILTPANTLYQVIANRPALLDCAFFGSPLPTIEWFKGAKGSALHEDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDATWIVKQPEYAVVQRGSMVSFECKVKHDHTLSLTVLWLKDNRELPSDERFTVDKDHLVVADVSDDDSGTYTCVANTTLDSVSASAVLSVV

Predict reactive species
Full Name neuronal cell adhesion molecule
Calculated Molecular Weight 1304 aa, 144 kDa
Observed Molecular Weight 130-140 kDa
GenBank Accession NumberBC098401
Gene Symbol NRCAM
Gene ID (NCBI) 4897
RRIDAB_3672990
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ92823
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Neuronal cell adhesion molecule (NRCAM) is a member of the L1 subfamily of cell adhesion molecules (CAMs) that belong to the immunoglobulin superfamily (PMID: 11329126). NRCAM is a transmembrane protein composed of six Ig-like domains and five fibronectin type-III repeats in the extracellular region, with a highly conserved cytoplasmic tail. It is mainly expressed in the nervous system and is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM is also expressed outside the nervous system. Altered expression of NRCAM has been associated with tumor progression in diverse organs (PMID: 22182708).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 NRCAM antibody CL488-68291Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...