NRXN2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NRXN2 Polyclonal antibody, PBS Only (30490-1-PBS)

• 

  IF Staining of rat brain using 30490-1-AP (same clone as 30490-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using NRXN2 antibody (30490-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), NeuN antibody (66836-1-Ig, Clone: 3A4C1, red). This data was developed using the same antibody clone with 30490-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 30490-1-AP (same clone as 30490-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using NRXN2 antibody (30490-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), NeuN antibody (66836-1-Ig, Clone: 3A4C1, red). This data was developed using the same antibody clone with 30490-1-PBS in a different storage buffer formulation.

NRXN2 Polyclonal Antibody for IF-P, Indirect ELISA

Cat No. 30490-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

IF-P, Indirect ELISA

Synonyms

---

Product Information

30490-1-PBS targets NRXN2 in IF-P, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32646

  Product name: Recombinant human NRXN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1480-1636 aa of NM_015080

  Sequence: ERDDSDCEEPIEASGFASGEVFDSSLPPTDDEDFYTTFPLVTDRTTLLSPRKPAPRPNLRTDGATGAPGVLFAPSAPAPNLPAGKMNHRDPLQPLLENPPLGPGAPTSFEPRRPPPLRPGVTSAPGFPHLPTANPTGPGERGPPGAVEVIRESSSTT

• Full Name: neurexin 2
• Calculated Molecular Weight: 185KD
• GenBank Accession Number: NM_015080
• Gene Symbol: NRXN2
• Gene ID (NCBI): 9379
• RRID: AB_3669727
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P58401
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The three members of the human neurexin gene family, neurexin 1 (NRXN1), neurexin 2 (NRXN2), and neurexin 3 (NRXN3), encode neuronal adhesion proteins that have important roles in synapse development and function (PMID: 22209245).