NeuN Monoclonal antibody

NeuN antibodies are widely used as neuronal markers to identify and quantify mature neurons in brain and spinal cord tissue in neuroscience research. Proteintech has an extensive range of NeuN antibodies validated for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA and Dot blot.
Cat No. 66836-1-Ig
Clone No.3A4C1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat and More (1)

Applications

IHC, IF-P, FC (Intra), ELISA

3A4C1, Fox-1 homolog C, FOX3, HRNBP3, NeuN antigen

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inrat cerebellum tissue, human brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat cerebellum tissue, mouse cerebellum tissue, rat brain tissue
Positive FC (Intra) detected inSH-SY5Y cells

This antibody is not suitable for staining in frozen section.

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:2500-1:10000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66836-1-Ig targets NeuN in IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, goat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28016

Product name: Recombinant human NeuN protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-100 aa of NM_001082575

Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR

Predict reactive species
Full Name hexaribonucleotide binding protein 3
GenBank Accession NumberNM_001082575
Gene Symbol NeuN
Gene ID (NCBI) 146713
RRIDAB_2882179
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDA6NFN3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NeuN, encoded by FOX3, is a neuron-specific nuclear protein. Anti-NeuN stains exclusively neuronal cells in the central and peripheral nervous systems, especially postmitotic and differentiating neurons, as well as terminally differentiated neurons. Anti-NeuN has been used widely as a reliable tool to detect most postmitotic neuronal cell types. The immunohistochemical staining is primarily localized in the nucleus of the neurons with lighter staining in the cytoplasm.

Protocols

Product Specific Protocols
FC protocol for NeuN antibody 66836-1-IgDownload protocol
IF protocol for NeuN antibody 66836-1-IgDownload protocol
IHC protocol for NeuN antibody 66836-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Cell Metab

Acetate enables metabolic fitness and cognitive performance during sleep disruption

Authors - Qinqin He
ratIF

Microbiome

The microbiota-gut-brain axis participates in chronic cerebral hypoperfusion by disrupting the metabolism of short-chain fatty acids.

Authors - Weiping Xiao
ratIF

Redox Biol

LOX-mediated ECM mechanical stress induces Piezo1 activation in hypoxic-ischemic brain damage and identification of novel inhibitor of LOX

Authors - Dongya Jiang
ratIF

Cell Death Dis

ChemR23 activation attenuates cognitive impairment in chronic cerebral hypoperfusion by inhibiting NLRP3 inflammasome-induced neuronal pyroptosis

Authors - Yaxuan Zhang
mouseIF

Cell Death Dis

Astrocyte-derived exosomal nicotinamide phosphoribosyltransferase (Nampt) ameliorates ischemic stroke injury by targeting AMPK/mTOR signaling to induce autophagy

Authors - Yang Deng
mouseIF

Diabetes

Regulatory Role of NF-κB on HDAC2 and Tau Hyperphosphorylation in Diabetic Encephalopathy and the Therapeutic Potential of Luteolin

Authors - Qian Fu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Deng (Verified Customer) (08-14-2025)

it works, but has some background (see image in mouse PVN region)

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: Mouse brain section
NeuN Antibody Immunofluorescence validation (1:250 dilution) in Mouse brain section (Cat no:66836-1-Ig)
FH

Carla (Verified Customer) (02-03-2025)

We didn't have any good results

  • Applications: Immunofluorescence
  • Cell Tissue Type: organoid/Brain tissue
FH

Kenzo (Verified Customer) (01-05-2024)

This monoclonal NeuN worked well for mouse tissues.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Retina
FH

Silvia (Verified Customer) (08-11-2022)

it works well for Immunofluorescence on mature neurons

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:300
  • Cell Tissue Type: hiPSCs-derived neurons
FH

Delphine (Verified Customer) (07-25-2022)

Immunohistochemistry with the NeuN antibody on frozen spinal cord worked but the labeling must be optimized because there is a lot of background noise.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1/200
  • Cell Tissue Type: tissue
FH

q (Verified Customer) (01-05-2022)

It is OK to use it in WB, but several non-specific bands above the expected MW.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: mouse brain lysate
NeuN Antibody Western Blot validation (1:2000 dilution) in mouse brain lysate (Cat no:66836-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...