NUBP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NUBP1 Polyclonal antibody, PBS Only (18011-1-PBS)

• 

  WB analysis using 18011-1-AP (same clone as 18011-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18011-1-AP (NUBP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18011-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 18011-1-AP (same clone as 18011-1-PBS)

  WB result of NUBP1 antibody (18011-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NUBP1 transfected HeLa cells. This data was developed using the same antibody clone with 18011-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 18011-1-AP (same clone as 18011-1-PBS)

  IP result of anti-NUBP1 (IP:18011-1-AP, 4ug; Detection:18011-1-AP 1:300) with Jurkat cells lysate 3600ug. This data was developed using the same antibody clone with 18011-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 18011-1-AP (same clone as 18011-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 18011-1-AP (NUBP1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18011-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NUBP1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 18011-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

Nucleotide binding protein 1, Nbp35, NBP1, NBP 1, NBP

---

Product Information

18011-1-PBS targets NUBP1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12510

  Product name: Recombinant human NUBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-309 aa of BC100290

  Sequence: MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS

• Full Name: nucleotide binding protein 1 (MinD homolog, E. coli)
• Calculated Molecular Weight: 309 aa, 33 kDa
• Observed Molecular Weight: 36-40 kDa
• GenBank Accession Number: BC100290
• Gene Symbol: NUBP1
• Gene ID (NCBI): 4682
• RRID: AB_2935446
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P53384
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.