NUDC Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NUDC Polyclonal antibody, PBS Only (10681-1-PBS)

• 

  WB analysis of HepG2 using 10681-1-AP (same clone as 10681-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10681-1-AP (NUDC antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10681-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 10681-1-AP (same clone as 10681-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 10681-1-AP (NUDC antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10681-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 10681-1-AP (same clone as 10681-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 10681-1-AP (NUDC antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10681-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 10681-1-AP (same clone as 10681-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10681-1-AP (NUDC antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10681-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 10681-1-AP (same clone as 10681-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 10681-1-AP (NUDC antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10681-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 10681-1-AP (same clone as 10681-1-PBS)

  IP result of anti-NUDC (IP:10681-1-AP, 4ug; Detection:10681-1-AP 1:1000) with HEK-293 cells lysate 2800ug. This data was developed using the same antibody clone with 10681-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 10681-1-AP (same clone as 10681-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 10681-1-AP (NUDC antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10681-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 10681-1-AP (same clone as 10681-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 10681-1-AP (NUDC antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10681-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 10681-1-AP (same clone as 10681-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NUDC antibody (10681-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 10681-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10681-1-AP (same clone as 10681-1-PBS)

  Immunofluorescent analysis of HepG2 cells using 10681-1-AP (NUDC antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10681-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 10681-1-AP (same clone as 10681-1-PBS)

  Immunofluorescent analysis of HEK-293 cells using 10681-1-AP (NUDC antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10681-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NUDC Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 10681-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

HNUDC, MNUDC

---

Product Information

10681-1-PBS targets NUDC in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0998

  Product name: Recombinant human NUDC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-331 aa of BC006147

  Sequence: MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN

• Full Name: nuclear distribution gene C homolog (A. nidulans)
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 42-45 kDa
• GenBank Accession Number: BC006147
• Gene Symbol: NUDC
• Gene ID (NCBI): 10726
• RRID: AB_2282933
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y266
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Nuclear distribution protein C (NudC) is a highly conserved dynein/dynactin associated protein implicated in mitosis and cytokinesis. NudC is localized on major mitotic structures, and is involved in regulating spindle formation stability of kinetochore microtubule attachments, and chromosomes congression in early mitosis. NudC also is required for multi-protein transport along axons in neurons.