NUMB Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85939-4-RR (same clone as 85939-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85939-4-RR (NUMB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85939-4-PBS in a different storage buffer formulation.

• 

  WB analysis using 85939-4-RR (same clone as 85939-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85939-4-RR (NUMB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85939-4-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 85939-4-RR (same clone as 85939-4-PBS)

  IP result of anti-NUMB (IP:85939-4-RR, 4ug; Detection:85939-4-RR 1:3000) with HeLa cells lysate 1600 ug. This data was developed using the same antibody clone with 85939-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 85939-4-RR (same clone as 85939-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 85939-4-RR (NUMB antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85939-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 85939-4-RR (same clone as 85939-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 85939-4-RR (NUMB antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85939-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85939-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85939-4-RR against Human NUMB were performed. The affinity constant is 1.15 nM.

NUMB Uni-rAb^® Recombinant Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 85939-4-PBS

Clone No.250417F6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

C14orf41, h Numb, h-Numb

---

Product Information

85939-4-PBS targets NUMB in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag31553

  Product name: Recombinant human NUMB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 510-651 aa of NM_001005743

  Sequence: SYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL

• Full Name: numb homolog (Drosophila)
• Calculated Molecular Weight: 71KD
• Observed Molecular Weight: 66-71 kDa
• GenBank Accession Number: NM_001005743
• Gene Symbol: NUMB
• Gene ID (NCBI): 8650
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49757
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NUMB, also named as S171, plays a role in the determination of cell fates during development. It is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. The degradation of NUMB is induced in a proteasome-dependent manner by MDM2. Four transcript variants encoding different isoforms have been found for this gene.