Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated NUP153 Recombinant monoclonal antibody

NUP153 Uni-rAb® Recombinant Antibody for IF/ICC

Cat No. CL488-86622
Clone No.251519G11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

153 kDa nucleoporin, HNUP153, N153, nucleoporin 153kDa, Nucleoporin Nup153

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells, HeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86622 targets NUP153 in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5519

Product name: Recombinant human NUP153 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1125-1475 aa of BC052965

Sequence: EEPKCQPVFSFGNSEQTKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQTSTTADQGAAKPVFSFLNNSSSSSSTPATSAGGGIFGSSTSSSNPPVATFVFGQSSNPVSSSAFGNTAESSTSQSLLFSQDSKLATTSSTGTAVTPFVFGPGASSNNTTTSGFGFGATTTSSSAGSSFVFGTGPSAPSASPAFGANQTPTFGQSQGASQPNPPGFGSISSSTALFPTGSQPAPPTFGTVSSSSQPPVFGQQPSQSAFGSGTTPNSSSAFQFGSSTTNFNFTNNSPSGVFTFGANSSTPAASAQPSGSGGFPFNQSPAAFTVGSNGKNVFSSSGTSFSGRKIKTAVRRRK

Predict reactive species
Full Name nucleoporin 153kDa
Calculated Molecular Weight 154 kDa
Observed Molecular Weight160-170 kDa
GenBank Accession NumberBC052965
Gene Symbol NUP153
Gene ID (NCBI) 9972
RRIDAB_3747854
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP49790
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NUP153 is an FG-repeat containing NUP, contains a high-affinity site for importin-β, localizes on the nucleoplasmic face of the nuclear pore and is required for assembly of the nuclear basket and import of a subset of nuclear proteins [PMID:18845677]. NUP153 also facilitates nuclear export of mRNA and ribonucleoprotein particles and may have additional functions within the nucleus [PMID:16195343]. The 53BP1-NUP153/importin-β pathway as an important aspect of the DDR network add to an emerging evidence of subcellular trafficking as an integral part of genome surveillance [PMID:22075984].

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 NUP153 antibody CL488-86622Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...