CoraLite® Plus 488-conjugated NUP155 Monoclonal antibody

• 

  WB analysis using CL488-66359

  Various lysates were subjected to SDS PAGE followed by western blot with CL488-66359 (NUP155 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

NUP155 Monoclonal Antibody for WB

Cat No. CL488-66359

Clone No.1A7F2

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat

Applications

WB

Synonyms

155 kDa nucleoporin, KIAA0791, N155, nucleoporin 155kDa, Nucleoporin Nup155, NUP155

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66359 targets NUP155 in WB applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3638

  Product name: Recombinant human NUP155 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1043-1391 aa of BC039257

  Sequence: LIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLERLH

• Full Name: nucleoporin 155kDa
• Calculated Molecular Weight: 1391 aa, 155 kDa
• Observed Molecular Weight: 140-155 kDa
• GenBank Accession Number: BC039257
• Gene Symbol: NUP155
• Gene ID (NCBI): 9631
• RRID: AB_3084237
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75694
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

NUP155 is a nucleoporin, the major component of the nuclear pore complex (NPC) that is essential for nuclear envelope biogenesis. Mutation of NUP155 has been linked to cardiovascular disease.