• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated OCIAD1 Monoclonal antibody

OCIAD1 Monoclonal Antibody for IF/ICC, IF-P
Cat No. CL488-66698
Clone No.1C10C3

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

IF/ICC, IF-P

Ovarian cancer immunoreactive antigen domain containing 1, OCIA domain-containing protein 1, OCIA domain containing 1, OCIA, ASRIJ

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman liver cancer tissue
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66698 targets OCIAD1 in IF/ICC, IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9977

Product name: Recombinant human OCIAD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-245 aa of BC003409

Sequence: MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE

Predict reactive species
Full Name OCIA domain containing 1
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC003409
Gene Symbol OCIAD1
Gene ID (NCBI) 54940
RRIDAB_2934487
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NX40
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

OCIAD1 was first identified by immunoscreening of an ovarian carcinoma cDNA expression library with ascites fluid from ovarian cancer patients (PMID: 11162530). OCIAD1 has been reported as a key player in ovarian cancer cell adhesion, as well as a key player in generating ovarian cancer recurrence (PMID: 18328549; 20515946). In addition to its roles in cancer, OCIAD1 participates in maintaining stem cell potency by regulating the Jak/STAT pathway (PMID: 23972987). Several alternatively spliced forms of OCIAD1 gene have been identified. The longest form (1.4 kb) is predicted to encode for a 27.6 kDa protein of 245 amino acids. This antibody detects OCIAD1 with an apparent molecular weight of ~35 kDa as has been demonstrated by several researches (PMID: 27345969; 27345976).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 OCIAD1 antibody CL488-66698Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...