OLR1/LOX1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• OLR1/LOX1 Recombinant monoclonal antibody (86194-3-RR)

• 

  WB analysis using 86194-3-RR

  Human placenta tissue was subjected to SDS PAGE followed by western blot with 86194-3-RR (OLR1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 86194-3-RR

  bEnd.3 cells were subjected to SDS PAGE followed by western blot with 86194-3-RR (OLR1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86194-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86194-3-RR against Human OLR1/LOX1 were performed. The affinity constant is 1.92 nM.

OLR1/LOX1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86194-3-RR

Clone No.250525A3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

OLR1, CLEC8A, C-type lectin domain family 8 member A, hLOX 1, hLOX1

---

Tested Applications

• Positive WB detected in: human placenta tissue, bEnd.3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86194-3-RR targets OLR1/LOX1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2911

  Product name: Recombinant Human OLR1/LOX1 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 61-273 aa of NM_002543.3

  Sequence: SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ

• Full Name: oxidized low density lipoprotein (lectin-like) receptor 1
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: NM_002543.3
• Gene Symbol: OLR1
• Gene ID (NCBI): 4973
• RRID: AB_3744703
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P78380-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OLR1/LOX-1 acts as a receptor, in the form of a homodimer, that mediates the recognition, internalization, and degradation of oxidatively modified low density lipoprotein (oxLDL) (PMID: 9052782, 15695803). ORL1 is predominantly expressed in endothelial cells and vascular-rich organs such as the placenta, lung, liver, and brain (PMID: 9828121). OLR1 is a protein containing 273 amino acids with a calculated molecular mass of 31 kDa but an apparent molecular mass of 50 kDa, which may result from the glycosylation of four potential N-linked glycosylation sites located at the C-terminal domain (PMID: 9052782).