ONECUT2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ONECUT2 Polyclonal antibody, PBS Only (21916-1-PBS)

• 

  WB analysis using 21916-1-AP (same clone as 21916-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21916-1-AP (ONECUT2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21916-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21916-1-AP (same clone as 21916-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21916-1-AP (ONECUT2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21916-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skin using 21916-1-AP (same clone as 21916-1-PBS)

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 21916-1-AP (ONECUT2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21916-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 21916-1-AP (same clone as 21916-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 21916-1-AP (ONECUT2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21916-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 21916-1-AP (same clone as 21916-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21916-1-AP (ONECUT2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21916-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 21916-1-AP (same clone as 21916-1-PBS)

  IP result of anti-ONECUT2 (IP:21916-1-AP, 4ug; Detection:21916-1-AP 1:300) with HEK-293 cells lysate 3200ug. This data was developed using the same antibody clone with 21916-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 21916-1-AP (same clone as 21916-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 21916-1-AP (ONECUT2 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21916-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ONECUT2 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 21916-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

21916-1-PBS targets ONECUT2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16162

  Product name: Recombinant human ONECUT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 226-332 aa of BC108925

  Sequence: PLAATPLGNGLGGLHNAQQSLPNYGPPGHDKMLSPNFDAHHTAMLTRGEQHLSRGLGTPPAAMMSHLNGLHHPGHTQSHGPVLAPSRERPPSSSSGSQVATSGQLEE

• Full Name: one cut homeobox 2
• Calculated Molecular Weight: 504 aa, 54 kDa
• Observed Molecular Weight: 54-60 kDa
• GenBank Accession Number: BC108925
• Gene Symbol: ONECUT2
• Gene ID (NCBI): 9480
• RRID: AB_2848180
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95948
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ONECUT2, also named as One cut domain family member 2 or Hepatocyte nuclear factor 6-beta, is a 504 amino acid protein, which contains one CUT DNA-binding domain and one homeobox DNA-binding domain. ONECUT2 belongs to the CUT homeobox family and activates the transcription of a number of liver genes such as HNF3B. ONECUT2 is required for liver differnetiation and metabolism. ONECUT2 and ONECUT3 play redundant roles with ONECUT1 in pancreas development.