OPCML Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• OPCML Recombinant monoclonal antibody, PBS Only (87815-1-PBS)

• 

  WB analysis of fetal human brain using 87815-1-RR (same clone as 87815-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 87815-1-RR (OPCML antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87815-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 87815-1-RR (same clone as 87815-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 87815-1-RR (OPCML antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87815-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 87815-1-RR (same clone as 87815-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using OPCML antibody (87815-1-RR, Clone: 252030F1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87815-1-PBS in a different storage buffer formulation.

OPCML Uni-rAb^® Recombinant Antibody for WB, IF-P, Indirect ELISA

Cat No. 87815-1-PBS

Clone No.252030F1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, Indirect ELISA

Synonyms

IgLON family member 1, IGLON1, OBCAM, Opioid-binding cell adhesion molecule, Opioid-binding protein/cell adhesion molecule

---

Product Information

87815-1-PBS targets OPCML in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6020

  Product name: Recombinant human OPCM protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 28-322 aa of NM_001012393.5

  Sequence: DATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVNSASRALA

• Full Name: opioid binding protein/cell adhesion molecule-like
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 40 kDa, 60 kDa
• GenBank Accession Number: NM_001012393.5
• Gene Symbol: OPCML
• Gene ID (NCBI): 4978
• RRID: AB_3745766
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14982-2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

OPCML, also called opioid-binding cell adhesion molecule (OBCAM), belongs to the IgLON limbic system-associated membrane protein (LSAMP, OPCML/OBCAM, neurotrimin) family of IgG domain-containing glycosylphosphatidylinositol-anchored cell adhesion molecules. Originally isolated from the brain, OPCML is also expressed in the stomach, ovary, heart, placenta, testis, kidney, liver, pancreas, and colon. OPCML has been identified as a tumour suppressor, which inhibited tumor growth in some cancers, including ovarian cancer, lung cancer, and prostate cancer (PMID: 19176311; 28407749).