OPCML Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• OPCML Recombinant monoclonal antibody (87815-1-RR)

• 

  WB analysis of fetal human brain using 87815-1-RR

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 87815-1-RR (OPCML antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 87815-1-RR

  rat brain tissue were subjected to SDS PAGE followed by western blot with 87815-1-RR (OPCML antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of mouse brain using 87815-1-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using OPCML antibody (87815-1-RR, Clone: 252030F1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

OPCML Uni-rAb^® Recombinant Antibody for WB, IF-P, ELISA

Cat No. 87815-1-RR

Clone No.252030F1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, ELISA

Synonyms

IgLON family member 1, IGLON1, OBCAM, Opioid-binding cell adhesion molecule, Opioid-binding protein/cell adhesion molecule

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, rat brain tissue
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87815-1-RR targets OPCML in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6020

  Product name: Recombinant human OPCM protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 28-322 aa of NM_001012393.5

  Sequence: DATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVNSASRALA

• Full Name: opioid binding protein/cell adhesion molecule-like
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 40 kDa, 60 kDa
• GenBank Accession Number: NM_001012393.5
• Gene Symbol: OPCML
• Gene ID (NCBI): 4978
• RRID: AB_3745766
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14982-2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OPCML, also called opioid-binding cell adhesion molecule (OBCAM), belongs to the IgLON limbic system-associated membrane protein (LSAMP, OPCML/OBCAM, neurotrimin) family of IgG domain-containing glycosylphosphatidylinositol-anchored cell adhesion molecules. Originally isolated from the brain, OPCML is also expressed in the stomach, ovary, heart, placenta, testis, kidney, liver, pancreas, and colon. OPCML has been identified as a tumour suppressor, which inhibited tumor growth in some cancers, including ovarian cancer, lung cancer, and prostate cancer (PMID: 19176311; 28407749).