Home
Products
Primary Antibodies
OPN1SW Polyclonal antibody, PBS Only (24660-1-PBS)

Filter: AllIHCIF-P

IHC staining of mouse eye using 24660-1-AP (same clone as 24660-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 24660-1-AP (OPN1SW antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24660-1-PBS in a different storage buffer formulation.
IF Staining of mouse eye using 24660-1-AP (same clone as 24660-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse eye tissue using OPN1SW antibody (24660-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24660-1-PBS in a different storage buffer formulation.
IF Staining of mouse eye using 24660-1-AP (same clone as 24660-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse eye tissue using OPN1SW antibody (24660-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24660-1-PBS in a different storage buffer formulation.
IF Staining of rat eye using 24660-1-AP (same clone as 24660-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat eye tissue using OPN1SW antibody (24660-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24660-1-PBS in a different storage buffer formulation.

OPN1SW Polyclonal antibody, PBS Only

Name: OPN1SW Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 24660-1-PBS

OPN1SW Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 24660-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, Indirect ELISA

Synonyms

Blue sensitive opsin, Blue-sensitive opsin, BOP, CBT, Short-wave-sensitive opsin 1

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

24660-1-PBS targets OPN1SW in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag20387 Product name: Recombinant human OPN1SW protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 265-348 aa of BC156719 Sequence: YAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN Predict reactive species
Full Name	opsin 1 (cone pigments), short-wave-sensitive
Calculated Molecular Weight	348 aa, 39 kDa
GenBank Accession Number	BC156719
Gene Symbol	OPN1SW
Gene ID (NCBI)	611
RRID	AB_3085746
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P03999
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

OPN1SW (Short-wave-sensitive opsin 1) belongs to the G-protein coupled receptor 1 family, opsin subfamily. It's one of three types of cone photoreceptors responsible for normal color vision. Inherited tritan color vision deficiencies exhibit an autosomal dominant inheritance pattern and are caused by mutations in OPN1SW (PMID: 32400513).