ORMDL3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ORMDL3 Polyclonal antibody, PBS Only (27598-1-PBS)

• 

  WB analysis using 27598-1-AP (same clone as 27598-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27598-1-AP (ORMDL3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27598-1-PBS in a different storage buffer formulation.

ORMDL3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27598-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

ORM1 like protein 3

---

Product Information

27598-1-PBS targets ORMDL3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26253

  Product name: Recombinant human ORMDL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC071833

  Sequence: MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRK

• Full Name: ORM1-like 3 (S. cerevisiae)
• Calculated Molecular Weight: 153 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC071833
• Gene Symbol: ORMDL3
• Gene ID (NCBI): 94103
• RRID: AB_3742242
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N138
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ORMDL3 (ORM1-like 3) is an endoplasmic-reticulum (ER)-resident transmembrane protein that negatively regulates serine palmitoyl-transferase (SPT), the first and rate-limiting enzyme of de-novo sphingolipid biosynthesis, thereby controlling cellular ceramide levels. (PMID: 31376405)