• Featured Product
  • KD/KO Validated

OS9 Recombinant monoclonal antibody

OS9 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 82932-1-RR
Clone No.230149B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), ELISA

230149B4, Amplified in osteosarcoma 9, Protein OS-9

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, HUVEC cells, U2OS cells
Positive IHC detected inmouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82932-1-RR targets OS9 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0106

Product name: Recombinant human OS9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 125-435 aa of BC000532

Sequence: GRHIQQYHMEDSEIKGEVLYLGYYQSAFDWDDETAKASKQHRLKRYHSQTYGNGSKCDLNGRPREAEVRFLCDEGAGISGDYIDRVDEPLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGASPTKDDSKDSDFWKMLNEPEDQAPGGEEVPAEEQDPSPEAADSASGAPNDFQNNVQVKVIRSPADLIRFIEELKGGTKKGKPNIGQEQPVDDAAEVPQREPEKERGDPERQREMEEEEDEDEDEDEDEDERQLLGE

Predict reactive species
Full Name osteosarcoma amplified 9, endoplasmic reticulum associated protein
Calculated Molecular Weight 76 kDa
Observed Molecular Weight83-97 kDa
GenBank Accession NumberBC000532
Gene Symbol OS9
Gene ID (NCBI) 10956
RRIDAB_3670673
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13438
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OS-9 is a ubiquitously expressed ensoplasmic reticulum (ER)-associated protein originally identified as being amplified in certain osteosarcomas. It functions in ER quality control and ER-associated degradation (ERAD). There are three isoforms of this protein: OS-9.1, OS-9.2 and OS-9.3. The longest isoform, OS-9.1, contains 667 aa, OS-9.2 lacks aa 535-589, whereas OS-9.3 lacks aa 456-470 and 535-589. OS-9.1 and OS-9.2 are N-glycosylated, ubiquitously expressed in human tissues, and amplified in tumors.

Protocols

Product Specific Protocols
WB protocol for OS9 antibody 82932-1-RRDownload protocol
IHC protocol for OS9 antibody 82932-1-RRDownload protocol
FC protocol for OS9 antibody 82932-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...