CoraLite® Plus 750-conjugated OS9 Recombinant monoclonal antibody

OS9 Recombinant Antibody for WB, FC (Intra)
Cat No. CL750-82932
Clone No.230149B4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra)

Protein OS-9, Amplified in osteosarcoma 9, 230149B4

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, HUVEC cells, U2OS cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-82932 targets OS9 in WB, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0106

Product name: Recombinant human OS9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 125-435 aa of BC000532

Sequence: GRHIQQYHMEDSEIKGEVLYLGYYQSAFDWDDETAKASKQHRLKRYHSQTYGNGSKCDLNGRPREAEVRFLCDEGAGISGDYIDRVDEPLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGASPTKDDSKDSDFWKMLNEPEDQAPGGEEVPAEEQDPSPEAADSASGAPNDFQNNVQVKVIRSPADLIRFIEELKGGTKKGKPNIGQEQPVDDAAEVPQREPEKERGDPERQREMEEEEDEDEDEDEDEDERQLLGE

Predict reactive species
Full Name osteosarcoma amplified 9, endoplasmic reticulum associated protein
Calculated Molecular Weight 76 kDa
Observed Molecular Weight83-97 kDa
GenBank Accession NumberBC000532
Gene Symbol OS9
Gene ID (NCBI) 10956
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13438
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

OS-9 is a ubiquitously expressed ensoplasmic reticulum (ER)-associated protein originally identified as being amplified in certain osteosarcomas. It functions in ER quality control and ER-associated degradation (ERAD). There are three isoforms of this protein: OS-9.1, OS-9.2 and OS-9.3. The longest isoform, OS-9.1, contains 667 aa, OS-9.2 lacks aa 535-589, whereas OS-9.3 lacks aa 456-470 and 535-589. OS-9.1 and OS-9.2 are N-glycosylated, ubiquitously expressed in human tissues, and amplified in tumors.

Protocols

Product Specific Protocols
WB protocol for CL Plus 750 OS9 antibody CL750-82932Download protocol
FC protocol for CL Plus 750 OS9 antibody CL750-82932Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...