Use Able AI chat for product recommendations

OSMR Recombinant monoclonal antibody

OSMR Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 84555-2-RR
Clone No.241865C8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

241865C8, IL-31 receptor subunit beta, IL-31R subunit beta, IL-31RB, IL-31R-beta

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, SH-SY5Y cells, Raji cells, A375 cells, HEK-293 cells, HepG2 cells, NIH/3T3 cells, PC-12 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84555-2-RR targets OSMR in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1426

Product name: Recombinant human OSMR protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-342 aa of BC010943

Sequence: MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRGETRVVTAHRGH

Predict reactive species
Full Name oncostatin M receptor
Calculated Molecular Weight 110 kDa
Observed Molecular Weight~180 kDa
GenBank Accession NumberBC010943
Gene Symbol OSMR
Gene ID (NCBI) 9180
RRIDAB_3672064
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ99650
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Oncostatin M (OSM) is a member of interleukin-6 family cytokines that modulates proliferation and differentiation in numerous cells (PMID: 22982441). OSM signals via a receptor complex comprising gp130 and the OSMR (also called OSMRβ) (PMID: 8999038). OSMR is a single-pass membrane protein that belongs to the type I cytokine receptor family. OSMR mRNA is expressed at relatively high levels in all neural cells and fibroblast, epithelial, and various tumor cell lines (PMID: 8999038). It has also been shown that OSMR associates with IL31RA to form the heterodimeric IL31 receptor (PMID: 15184896). OMSR has a calculated molecular weight of 110 kDa, with an apparent molecular weight of 150-180 kDa (PMID: 8999038; 17028186; 39266541; 34644107). A 70 kDa soluble form can be detected by western blot (PMID: 17028186).

Protocols

Product Specific Protocols
WB protocol for OSMR antibody 84555-2-RRDownload protocol
FC protocol for OSMR antibody 84555-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...