OTULIN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• OTULIN Polyclonal antibody, PBS Only (27392-1-PBS)

OTULIN Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27392-1-PBS Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

FAM105B, Deubiquitinating enzyme otulin, EC:3.4.19.12, OTU domain-containing deubiquitinase with linear linkage specificity, Protein FAM105B

• 

  WB analysis using 27392-1-AP (same clone as 27392-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27392-1-AP (OTULIN antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27392-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 27392-1-AP (same clone as 27392-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 27392-1-AP (OTULIN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27392-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for OTULIN in ?

Chat with Able

---

Product Information

27392-1-PBS targets OTULIN in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22302

  Product name: Recombinant human FAM105B protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-214 aa of BC007706

  Sequence: MSQAVGLPPWLQDPELMLLPEKLISKYNWIKQWKLGLKFDGKNEDLVDKIKESLTLLRKKWAGLAEMRTAEARQIACDELFTNEAEEYSLYEAVKFLMLNRAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITVYPTDPPKDWPVVTLIAEDDRHYNIPVRVCEETSL

• Full Name: family with sequence similarity 105, member B
• Calculated Molecular Weight: 352 aa, 40 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: BC007706
• Gene Symbol: FAM105B
• Gene ID (NCBI): 90268
• RRID: AB_3085952
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96BN8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Linear ubiquitination is negatively regulated by OTULIN (OTU deubiquitinase with linear linkage specificity, also known as Fam105b or Gumby), a deubiquitinase specifically catalysing the degradation of linear ubiquitin chains. OUb signalling is antagonised by deubiquitinases (DUBs), which cleave the polyUb signal from substrates to terminate signalling. OTU DUB with linear linkage specificity (OTULIN) and CYLD are the two main DUBs that regulate M1-polyUb signalling. OTULIN exclusively cleaves M1 linkages, whereas CYLD cleaves both M1 and K63 linkages. OTULIN binds directly to the LUBAC subunit HOIP and regulates LUBAC signalling, autoubiquitination, and stability.(PMID: 34625557, PMID: 32231246)