PE Anti-Mouse OX40L/TNFSF4 Rabbit Recombinant Antibody

• 

  FC experiment of BALB/c mouse splenocytes using PE-98381

  1x10^6 untreated or Anti-IgM and CD40 treated BALB/c mouse splenocytes were surface stained with CoraLite® Plus 647 Anti-Mouse CD19 and 0.25 ug PE Anti-Mouse OX40L/TNFSF4 Rabbit RecAb (PE-98381, Clone:242227B1). Cells were not fixed.

• 

  FC experiment of BALB/c mouse splenocytes using PE-98381

  1x10^6 Anti-IgM and CD40 treated BALB/c mouse splenocytes were surface stained with 0.25 ug PE Anti-Mouse OX40L/TNFSF4 Rabbit RecAb (PE-98381, Clone: 242227B1) (red), or PE Rabbit IgG Isotype Control RecAb (PE-98136, Clone: 240953C9) (blue). 1x10^6 untreated BALB/c mouse splenocytes were surface stained with 0.25 ug PE Anti-Mouse OX40L/TNFSF4 Rabbit RecAb (PE-98381, Clone: 242227B1)(black, dashed). Cells were not fixed.

OX40L/TNFSF4 Uni-rAb^® Recombinant Antibody for FC

Cat No. PE-98381

Clone No.242227B1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD252, OX40 ligand, OX40L, Tnfsf4, Tumor necrosis factor ligand superfamily member 4

---

Tested Applications

• Positive FC detected in: Anti-IgM and CD40 treated BALB/c mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

PE-98381 targets OX40L/TNFSF4 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1573

  Product name: Recombinant Mouse OX40L/TNFSF4 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 51-198 aa of NM_009452.2

  Sequence: SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL

• Full Name: tumor necrosis factor (ligand) superfamily, member 4
• Calculated Molecular Weight: 22kDa
• GenBank Accession Number: NM_009452.2
• Gene Symbol: Tnfsf4
• Gene ID (NCBI): 22164
• Conjugate: PE Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 578 nm
• Excitation Laser: Blue Laser (488 nm), Green Laser (532 nm), Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P43488
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

The tumour necrosis factor ligand superfamily member 4 gene (TNFSF4, OX40L), which encodes for the T cell costimulatory molecule OX40 ligand, has been identified as a susceptibility gene for the development of systemic lupus erythematosus (SLE). OX40L/TNFSF4/CD252 is a co-stimulatory checkpoint protein expressed by several types of immune and non-immune cells (PMID: 15750594, 19778912). TNFSF4 mRNA is expressed in melanoma cell lines and melanoma samples, including those with low lymphocytic infiltrates, and is not associated with the ulceration status of the primary tumor (PMID: 31501955).