CoraLite® Plus 488-conjugated P130 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated P130 Recombinant monoclonal antibody (CL488-87016)

• 

  IF Staining of HepG2 using CL488-87016

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 P130 antibody (CL488-87016, Clone: 252136E4 ) at dilution of 1:200, CL594-phalloidin (red).

P130 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-87016

Clone No.252136E4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

NOLC1, HCV NS5A-transactivated protein 13, Hepatitis C virus NS5A-transactivated protein 13, KIAA0035, NOPP130

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-87016 targets P130 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2382

  Product name: Recombinant human P130 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 69-418 aa of BC006769

  Sequence: TKPPPAKKAAESSSDSSDSDSSEDDEAPSKPAGTTKNSSNKPAVTTKSPAVKPAAAPKQPVGGGQKLLTRKADSSSSEEESSSSEEEKTKKMVATTKPKATAKAALSLPAKQAPQGSRDSSSDSDSSSSEEEEEKTSKSAVKKKPQKVAGGAAPSKPASAKKGKAESSNSSSSDDSSEEEEEKLKGKGSPRPQAPKANGTSALTAQNGKAAKNSEEEEEEKKKAAVVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE

• Full Name: nucleolar and coiled-body phosphoprotein 1
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: BC006769
• Gene Symbol: NOLC1
• Gene ID (NCBI): 9221
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14978
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Nucleolar and coiled-body phosphoprotein 1 (NOLC1) is a phosphoprotein that transiently associates with the mature nucleolar H/ACA and C/D box small nucleolar ribonucleoproteins (snoRNPs), guiding site-specific 2'-O-meth-ylation and pseudouridylation of pre-rRNAs [PMID:21266110]. It contains a nuclear localization signal binding sequence and is thought to shuttle between the nucleolus and the cytoplasm. NOLC1 plays an essential role in the synthesis of rRNA and the biosynthesis of ribosomes [PMID:8972203].