CoraLite®594-conjugated PALLD,palladin Monoclonal antibody

• 

  IF Staining of mouse testis using CL594-66601

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using CoraLite®594 PALLD,palladin antibody (CL594-66601, Clone: 2A1F6 ) at dilution of 1:200.

PALLD,palladin Monoclonal Antibody for IF-P

Cat No. CL594-66601

Clone No.2A1F6

Host / Isotype

Mouse / IgG2a

Reactivity

Human, rat, pig

Applications

IF-P

Synonyms

CGI 151, FLJ22190, FLJ38193, FLJ39139, KIAA0992, palladin, PALLD, PALLD,palladin, PNCA1, Sarcoma antigen NY SAR 77, SIH002

---

Tested Applications

• Positive IF-P detected in: mouse testis tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66601 targets PALLD,palladin in IF-P applications and shows reactivity with Human, rat, pig samples.

• Tested Reactivity: Human, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1288

  Product name: Recombinant human PALLD,palladin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 127-510 aa of BC013867

  Sequence: APFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANPQGRISCTGRLMVQAVNQRGRSPRSPSGHPHVRRPRSRSRDSGDENEPIQERFFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGVHSLIIEPVTSRDAGIYTCIATNRAGQNSFSLELVVAAKEAHKPPVFIEKLQNTGVADGYPVRLECRVLGVPPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCTARLDVYTQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL

• Full Name: palladin, cytoskeletal associated protein
• Calculated Molecular Weight: 1383 aa, 151 kDa
• Observed Molecular Weight: 151 kDa
• GenBank Accession Number: BC013867
• Gene Symbol: palladin
• Gene ID (NCBI): 23022
• RRID: AB_3673506
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8WX93
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.