• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated PAX8 Polyclonal antibody

PAX8 Polyclonal Antibody for IF/ICC, IF-P
Cat No. CL647-10336

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, IF-P

PAX-8, paired box 8, Paired box protein Pax 8, Paired box protein Pax-8, PAX 8

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse kidney tissue
Positive IF/ICC detected inSKOV-3 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-10336 targets PAX8 in IF/ICC, IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0306

Product name: Recombinant human PAX8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-212 aa of BC001060

Sequence: MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDS

Predict reactive species
Full Name paired box 8
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 48 kDa, 58 kDa
GenBank Accession NumberBC001060
Gene Symbol PAX8
Gene ID (NCBI) 7849
RRIDAB_2920213
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ06710
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PAX8 is a member of the paired box (PAX) family of transcription factors, typically containing a paired box domain and a paired-type homeodomain. It is expressed during organogenesis of the thyroid gland, kidney and Mullerian system. It is thought to regulate the expression of Wilms tumor suppressor (WT1) gene and mutations in PAX8 have been associated with Wilms tumor cells, thyroid and ovarian carcinomas. PAX8 is a useful marker in distinguishing ovarian carcinomas from mammary carcinomas (PMID: 18724243). PAX8 is expressed in a high percentage of ovarian serous, endometrioid, and clear cell carcinomas, but only rarely in primary ovarian mucinous adenocarcinomas.

This antibody can detect all 5 isoforms of PAX8 (31 kDa, 34 kDa, 41 kDa, 43 kDa and 48 kDa). A 58-60 kDa form has also been reported (PMID:15650356, 1049952). Proteintech's 10336-1-AP antibody has cross-reactivities with the other PAX family members.

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 PAX8 antibody CL647-10336Download protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Janett (Verified Customer) (07-03-2024)

Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human fallopian tube tissue using CoraLite® Plus 647 PAX8 antibody (CL647-10336). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0) in a steamer for 20min and Antibody Dilution 1:50

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: FFPE / fallopian tube
CL Plus 647 PAX8 Antibody Immunofluorescence validation (1:50 dilution) in FFPE / fallopian tube (Cat no:CL647-10336)
Loading...
||
New chat Able
正在加载,请稍候...