Tested Applications
| Positive IF-P detected in | mouse kidney tissue |
| Positive IF/ICC detected in | SKOV-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL647-10336 targets PAX8 in IF/ICC, IF-P applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0306 Product name: Recombinant human PAX8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC001060 Sequence: MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDS Predict reactive species |
| Full Name | paired box 8 |
| Calculated Molecular Weight | 48 kDa |
| Observed Molecular Weight | 48 kDa, 58 kDa |
| GenBank Accession Number | BC001060 |
| Gene Symbol | PAX8 |
| Gene ID (NCBI) | 7849 |
| RRID | AB_2920213 |
| Conjugate | CoraLite® Plus 647 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 654 nm / 674 nm |
| Excitation Laser | Red Laser (633 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q06710 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PAX8 is a member of the paired box (PAX) family of transcription factors, typically containing a paired box domain and a paired-type homeodomain. It is expressed during organogenesis of the thyroid gland, kidney and Mullerian system. It is thought to regulate the expression of Wilms tumor suppressor (WT1) gene and mutations in PAX8 have been associated with Wilms tumor cells, thyroid and ovarian carcinomas. PAX8 is a useful marker in distinguishing ovarian carcinomas from mammary carcinomas (PMID: 18724243). PAX8 is expressed in a high percentage of ovarian serous, endometrioid, and clear cell carcinomas, but only rarely in primary ovarian mucinous adenocarcinomas.
This antibody can detect all 5 isoforms of PAX8 (31 kDa, 34 kDa, 41 kDa, 43 kDa and 48 kDa). A 58-60 kDa form has also been reported (PMID:15650356, 1049952). Proteintech's 10336-1-AP antibody has cross-reactivities with the other PAX family members.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 647 PAX8 antibody CL647-10336 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PAX8 antibody (catalog CL647-10336, a CoraLite® Plus 647 conjugate) has 1 citation. It appears in Molecular Systems Biology, in a study on spatial proteomics of ovarian cancer precursors, identifying early disease changes and drug targets. The associated research field is ovarian cancer / spatial proteomics, using immunofluorescence (IF) on human samples.
| Species | Application | Title |
|---|---|---|
Mol Syst Biol Spatial proteomics of ovarian cancer precursors delineates early disease changes and drug targets. |
Reviews
What customers say
The single review for this product is a 5-star rating for an immunofluorescence application. The user performed immunofluorescent analysis on 4% PFA-fixed, paraffin-embedded human fallopian tube tissue using the CoraLite® Plus 647 PAX8 antibody at a 1:50 dilution. Antigen retrieval was done via heat-mediated Tris-EDTA buffer (pH 9.0) in a steamer for 20 minutes. The result was reported as successful, reflecting strong performance for FFPE tissue staining.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Janett (Verified Customer) (07-03-2024) | Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human fallopian tube tissue using CoraLite® Plus 647 PAX8 antibody (CL647-10336). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0) in a steamer for 20min and Antibody Dilution 1:50
 |
