PCF11 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PCF11 Polyclonal antibody, PBS Only (23540-1-PBS)

• 

  WB analysis of K-562 using 23540-1-AP (same clone as 23540-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 23540-1-AP (PCF11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23540-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 23540-1-AP (same clone as 23540-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 23540-1-AP (PCF11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23540-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 23540-1-AP (same clone as 23540-1-PBS)

  IP result of anti-PCF11 (IP:23540-1-AP, 4ug; Detection:23540-1-AP 1:2000) with Jurkat cells lysate 1400 ug. This data was developed using the same antibody clone with 23540-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 23540-1-AP (same clone as 23540-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 23540-1-AP (PCF11 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23540-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PCF11 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 23540-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

KIAA0824, Pre-mRNA cleavage complex 2 protein Pcf11, Pre-mRNA cleavage complex II protein Pcf11

---

Product Information

23540-1-PBS targets PCF11 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20263

  Product name: Recombinant human PCF11 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1206-1555 aa of BC146778

  Sequence: IPAPMTVGNIQASQQVLSGVAQPVAFGQGQQFLPVHPQNPGFVQNPSGALPKAYPDNHLSQVDVNELFSKLLKTGILKLSQTDSATTQVSEVTAQPPPEEEEDQNEDQDVPDLTNFTVEELKQRYDSVINRLYTGIQCYSCGMRFTTSQTDVYADHLDWHYRQNRTEKDVSRKVTHRRWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAGPAGAVESCEICQEQFEQYWDEEEEEWHLKNAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVENPLNIMLNIVKNELQEPCDSPKVKEERIDTPPACTEESIATPSEIKTENDTVESV

• Full Name: PCF11, cleavage and polyadenylation factor subunit, homolog (S. cerevisiae)
• Calculated Molecular Weight: 1555 aa, 173 kDa
• Observed Molecular Weight: 173 kDa
• GenBank Accession Number: BC146778
• Gene Symbol: PCF11
• Gene ID (NCBI): 51585
• RRID: AB_2879293
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: O94913
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

In Saccharomyces cerevisiae, the cleavage/polyadenylation factor Pcf11 is a crucial regulatory factor required for recruiting polyadenylation machinery to elongating RNA polymerase II (RNAPII), and is necessary for correct transcriptional termination. Pcf11 (PCF11, cleavage and polyadenylation factor subunit, homolog (S. cerevisiae)), is a 1,555 amino acid nuclear protein that is a component of pre-mRNA cleavage complex II. It is suggested that Pcf11 is capable of promoting the dissociation of Pol II elongation complexes from DNA. Pcf11 contains a CTD-interaction domain that binds in a phospho-dependent manner to the heptad repeats within the RNA polymerase II CTD. The gene encoding Pcf11 is located on human chromosoem 11, which houses over 1,400 genes and comprises nearly 4% of the human genome. Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema and Smith-Lemli-Opitz syndrome are associated with defects in genes that maps to chromosome 11. This antibody is specific to the 173kd human PCF11 protein.